PDB entry 1okg

View 1okg on RCSB PDB site
Description: 3-mercaptopyruvate sulfurtransferase from leishmania major
Class: transferase
Keywords: mercaptopyruvate, sulfurtransferase, rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate, transferase
Deposited on 2003-07-24, released 2003-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible 3-mercaptopyruvate sulfurtransferase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NE49 (Start-369)
      • engineered mutation (366)
    • PDB 1OKG (370-372)
    Domains in SCOPe 2.05: d1okga1, d1okga2, d1okga3
  • Heterogens: CA, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okgA (A:)
    msapaaapkhpgkvfldpsevadhlaeyrivdcryslkikdhgsiqyakehvksairadv
    dtnlsklvptstarhplppcaefidwcmangmagelpvlcyddecgamggcrlwwmlnsl
    gadayvinggfqackaaglemesgepsslprpathwpfktafqhhylvdeippqaiitda
    rsadrfastvrpyaadkmpghiegarnlpytshlvtrgdgkvlrseeeirhnimtvvqga
    gdaadlssfvfscgsgvtacinialvhhlglghpylycgswseysglfrppimrsiiddy
    gmcmqmqtpslgdnpkanldtmtlkvdgapcerpdaevqsaathlhageaatvyfksgrv
    vtievpvvpnlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okgA (A:)
    apkhpgkvfldpsevadhlaeyrivdcryslkikdhgsiqyakehvksairadvdtnlsk
    lvptstarhplppcaefidwcmangmagelpvlcyddecgamggcrlwwmlnslgadayv
    inggfqackaaglemesgepsslprpathwpfktafqhhylvdeippqaiitdarsadrf
    astvrpyaadkmpghiegarnlpytshlvtrgdgkvlrseeeirhnimtvvqadlssfvf
    scgsgvtacinialvhhlglghpylycgswseysglfrppimrsiiddygmcmqmqtpsl
    gdnpkanldtmtlkvdgapcerpdaevqsaathlhageaatvyfksgrvvtievpvvpnl
    ea