Lineage for d1okba_ (1okb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463295Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2463296Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2463297Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2463298Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2463299Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries)
  8. 2463300Domain d1okba_: 1okb A: [93246]
    complexed with cl, gol

Details for d1okba_

PDB Entry: 1okb (more details), 1.9 Å

PDB Description: crystal structure of uracil-dna glycosylase from atlantic cod (gadus morhua)
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1okba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okba_ c.18.1.1 (A:) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]}
meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
hvlqavhpsplsahrgflgckhfskangllklsgtepinwral

SCOPe Domain Coordinates for d1okba_:

Click to download the PDB-style file with coordinates for d1okba_.
(The format of our PDB-style files is described here.)

Timeline for d1okba_: