Lineage for d1okba_ (1okb A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390728Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 390729Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 390730Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 390731Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 390732Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (1 PDB entry)
  8. 390733Domain d1okba_: 1okb A: [93246]

Details for d1okba_

PDB Entry: 1okb (more details), 1.9 Å

PDB Description: crystal structure of uracil-dna glycosylase from atlantic cod (gadus morhua)

SCOP Domain Sequences for d1okba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okba_ c.18.1.1 (A:) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua)}
meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
hvlqavhpsplsahrgflgckhfskangllklsgtepinwral

SCOP Domain Coordinates for d1okba_:

Click to download the PDB-style file with coordinates for d1okba_.
(The format of our PDB-style files is described here.)

Timeline for d1okba_: