Class g: Small proteins [56992] (91 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries) |
Domain d1ojwa2: 1ojw A:65-128 [93157] intact protein complexed with gol, so4 |
PDB Entry: 1ojw (more details), 2.3 Å
SCOPe Domain Sequences for d1ojwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojwa2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave fckk
Timeline for d1ojwa2:
View in 3D Domains from other chains: (mouse over for more information) d1ojwb1, d1ojwb2, d1ojwb3, d1ojwb4 |