SCOPe 2.04: Domain d1ojwa1: 1ojw A:2-64

Lineage for d1ojwa1 (1ojw A:2-64)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)

8. Domain d1ojwa1: 1ojw A:2-64 [93156]
   intact protein
   complexed with gol, so4

Details for d1ojwa1

PDB Entry: 1ojw, 2.3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

PDB Compounds: (A:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ojwa1:

Sequence; same for both SEQRES and ATOM records:

>d1ojwa1 g.18.1.1 (A:2-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
qdcglppdvpnaqpalegrtsfpedtvitykceesfvkipgekdsviclkgsqwsdieef
cnr

Timeline for d1ojwa1:

• d1ojwa1 first appeared in SCOP 1.67
  
• d1ojwa1 appears in SCOPe 2.03
  
• d1ojwa1 appears in SCOPe 2.05
  
• d1ojwa1 appears in the current release, SCOPe 2.08