![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) ![]() |
![]() | Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins) Pfam 00650 |
![]() | Protein Alpha-tocopherol transfer protein [102203] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries) |
![]() | Domain d1oipa2: 1oip A:91-275 [93072] Other proteins in same PDB: d1oipa1 complexed with so4, vit |
PDB Entry: 1oip (more details), 1.95 Å
SCOP Domain Sequences for d1oipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oipa2 c.13.1.1 (A:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens)} siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl ssise
Timeline for d1oipa2: