Lineage for d1oipa2 (1oip A:91-275)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
core: 4 turns of a (beta-alpha)n superhelix
Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) 
Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
Pfam 00650Protein Alpha-tocopherol transfer protein [102203] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries) 
Domain d1oipa2: 1oip A:91-275 [93072]
Other proteins in same PDB: d1oipa1
complexed with so4, vit
Details for d1oipa2
PDB Entry: 1oip (more details), 1.95 Å
PDB Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
SCOP Domain Sequences for d1oipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oipa2 c.13.1.1 (A:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens)}
siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq
rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl
ssise
SCOP Domain Coordinates for d1oipa2:
Click to download the PDB-style file with coordinates for d1oipa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oipa2:
- d1oipa2 is new in SCOP 1.67
- d1oipa2 appears in SCOP 1.69
- d1oipa2 appears in the current release, SCOPe 2.08
View in 3D