PDB entry 1oip

View 1oip on RCSB PDB site
Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
Deposited on 2003-06-24, released 2004-01-14
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-14, with a file datestamp of 2004-01-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19154
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oipA (A:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oipA (A:)
    qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
    adlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitseliv
    qevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifh
    avfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfim
    ksedylssise