Lineage for d1oipa2 (1oip A:91-275)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480349Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 480350Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) (S)
  5. 480351Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
    Pfam 00650
  6. 480352Protein Alpha-tocopherol transfer protein [102203] (1 species)
  7. 480353Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries)
  8. 480357Domain d1oipa2: 1oip A:91-275 [93072]
    Other proteins in same PDB: d1oipa1

Details for d1oipa2

PDB Entry: 1oip (more details), 1.95 Å

PDB Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein

SCOP Domain Sequences for d1oipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oipa2 c.13.1.1 (A:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens)}
siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq
rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl
ssise

SCOP Domain Coordinates for d1oipa2:

Click to download the PDB-style file with coordinates for d1oipa2.
(The format of our PDB-style files is described here.)

Timeline for d1oipa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oipa1