Class a: All alpha proteins [46456] (202 folds) |
Fold a.204: Type II deoxyuridine triphosphatase [101385] (1 superfamily) multihelical; consists of 2 all-alpha subdomains, "rigid" one and "mobile" one |
Superfamily a.204.1: Type II deoxyuridine triphosphatase [101386] (1 family) |
Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein) |
Protein Type II deoxyuridine triphosphatase [101388] (1 species) |
Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries) |
Domain d1ogka_: 1ogk A: [92918] |
PDB Entry: 1ogk (more details), 2.85 Å
SCOP Domain Sequences for d1ogka_:
Sequence, based on SEQRES records: (download)
>d1ogka_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi} vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt dmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgq rtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfn lvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkaw ekiacsvfdafgmpeeerrhaydwlksaald
>d1ogka_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi} vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt dmhnvrieiadilhfslsgeiqkrddvalkslkemgffcrppaddellelmffpltevas avatfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlednellhec vqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaald
Timeline for d1ogka_: