Lineage for d1ogke_ (1ogk E:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362556Fold a.204: Type II deoxyuridine triphosphatase [101385] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains, "rigid" one and "mobile" one
  4. 362557Superfamily a.204.1: Type II deoxyuridine triphosphatase [101386] (1 family) (S)
  5. 362558Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
  6. 362559Protein Type II deoxyuridine triphosphatase [101388] (1 species)
  7. 362560Species Trypanosoma cruzi [TaxId:5693] [101389] (2 PDB entries)
  8. 362565Domain d1ogke_: 1ogk E: [92921]
    complexed with dud

Details for d1ogke_

PDB Entry: 1ogk (more details), 2.85 Å

PDB Description: the crystal structure of trypanosoma cruzi dutpase in complex with dudp

SCOP Domain Sequences for d1ogke_:

Sequence, based on SEQRES records: (download)

>d1ogke_ a.204.1.1 (E:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi}
vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt
dmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppahakstaasgq
rtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkglllaaqdldfn
lvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvlnegtylkaw
ekiacsvfdafgmpeeerrhaydwlksaald

Sequence, based on observed residues (ATOM records): (download)

>d1ogke_ a.204.1.1 (E:) Type II deoxyuridine triphosphatase {Trypanosoma cruzi}
vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt
dmhnvrieiadilhfslsgeiqkrdvalkslkemgffcrppdellelmffpltevasava
tfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvr
egvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaa
ld

SCOP Domain Coordinates for d1ogke_:

Click to download the PDB-style file with coordinates for d1ogke_.
(The format of our PDB-style files is described here.)

Timeline for d1ogke_: