Lineage for d1ogja1 (1ogj A:9-141)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952409Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 952431Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 952451Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 952452Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (24 PDB entries)
  8. 952455Domain d1ogja1: 1ogj A:9-141 [92916]
    Other proteins in same PDB: d1ogja2
    complexed with fad, so4; mutant

Details for d1ogja1

PDB Entry: 1ogj (more details), 1.64 Å

PDB Description: ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)
PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOPe Domain Sequences for d1ogja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogja1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d1ogja1:

Click to download the PDB-style file with coordinates for d1ogja1.
(The format of our PDB-style files is described here.)

Timeline for d1ogja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogja2