SCOP 1.67: Domain d1ogja1: 1ogj A:9-141

Lineage for d1ogja1 (1ogj A:9-141)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (19 PDB entries)

8. Domain d1ogja1: 1ogj A:9-141 [92916]
   Other proteins in same PDB: d1ogja2
   complexed with fad, so4; mutant

Details for d1ogja1

PDB Entry: 1ogj, 1.64 Å

PDB Description: ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)

SCOP Domain Sequences for d1ogja1:

Sequence; same for both SEQRES and ATOM records:

>d1ogja1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

Timeline for d1ogja1:

• d1ogja1 is new in SCOP 1.67
  
• d1ogja1 appears in SCOP 1.69
  
• d1ogja1 appears in the current release, SCOPe 2.08