SCOPe 2.08: Domain d1oeya1: 1oey A:352-428

Lineage for d1oeya1 (1oey A:352-428)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) [102790] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102791] (1 PDB entry)

8. Domain d1oeya1: 1oey A:352-428 [92800]
   Other proteins in same PDB: d1oeya2, d1oeyb2, d1oeyd2, d1oeyj_, d1oeyk_, d1oeyl_, d1oeym_

Details for d1oeya1

PDB Entry: 1oey, 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase

PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1oeya1:

Sequence; same for both SEQRES and ATOM records:

>d1oeya1 d.15.2.2 (A:352-428) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]}
ytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsmk
dawgqvknycltlwcen

Timeline for d1oeya1:

• d1oeya1 first appeared in SCOP 1.67, called d1oeya_
  
• d1oeya1 appears in SCOPe 2.07