Lineage for d1oeyd1 (1oey D:352-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933649Protein Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) [102790] (1 species)
  7. 2933650Species Human (Homo sapiens) [TaxId:9606] [102791] (1 PDB entry)
  8. 2933654Domain d1oeyd1: 1oey D:352-428 [92803]
    Other proteins in same PDB: d1oeya2, d1oeyb2, d1oeyd2, d1oeyj_, d1oeyk_, d1oeyl_, d1oeym_

Details for d1oeyd1

PDB Entry: 1oey (more details), 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
PDB Compounds: (D:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1oeyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeyd1 d.15.2.2 (D:352-428) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]}
ytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsmk
dawgqvknycltlwcen

SCOPe Domain Coordinates for d1oeyd1:

Click to download the PDB-style file with coordinates for d1oeyd1.
(The format of our PDB-style files is described here.)

Timeline for d1oeyd1: