PDB entry 1oey

View 1oey on RCSB PDB site
Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Class: immune system
Keywords: immune system, pb1 heterodimer-complex, nadph oxidase, pb1 domain, heterodimerization
Deposited on 2003-04-02, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (0-4)
    • Uniprot P19878 (5-End)
    Domains in SCOPe 2.07: d1oeya1, d1oeya2
  • Chain 'B':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (Start-4)
    • Uniprot P19878 (5-End)
    Domains in SCOPe 2.07: d1oeyb1, d1oeyb2
  • Chain 'C':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY
    • Uniprot P19878 (5-End)
    Domains in SCOPe 2.07: d1oeyc_
  • Chain 'D':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (Start-4)
    • Uniprot P19878 (5-End)
    Domains in SCOPe 2.07: d1oeyd1, d1oeyd2
  • Chain 'J':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (Start-3)
      • engineered mutation (9)
    • Uniprot Q15080 (4-106)
    Domains in SCOPe 2.07: d1oeyj_
  • Chain 'K':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (Start-3)
      • engineered mutation (9)
    • Uniprot Q15080 (4-106)
    Domains in SCOPe 2.07: d1oeyk_
  • Chain 'L':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY (Start-3)
      • engineered mutation (9)
    • Uniprot Q15080 (4-106)
    Domains in SCOPe 2.07: d1oeyl_
  • Chain 'M':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEY
      • engineered mutation (9)
    • Uniprot Q15080 (4-106)
    Domains in SCOPe 2.07: d1oeym_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oeyA (A:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyA (A:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oeyB (B:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyB (B:)
    aytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsm
    kdawgqvknycltlwce
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oeyC (C:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyC (C:)
    ytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsmk
    dawgqvknycltlwcen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oeyD (D:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyD (D:)
    maytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplseds
    mkdawgqvknycltlwcen
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1oeyJ (J:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyJ (J:)
    hmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdl
    vrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oeyK (K:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyK (K:)
    mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
    rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oeyL (L:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyL (L:)
    mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
    rllsdedvalmvrqargrlfpwklhitqkdnyrvyntmp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oeyM (M:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyM (M:)
    tnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlvr
    llsdedvalmvrqarkrlfpwklhitqkdnyrvyntmp