Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins) automatically mapped to Pfam PF05067 |
Protein Manganese catalase (T-catalase) [47263] (2 species) |
Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries) |
Domain d1o9id_: 1o9i D: [92674] complexed with ca, mes, mn3, na, o; mutant |
PDB Entry: 1o9i (more details), 1.33 Å
SCOPe Domain Sequences for d1o9id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9id_ a.25.1.3 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]} mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsflsqgwastgaekykdlll dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft yqenpeamggiphikpgdprlhnhqg
Timeline for d1o9id_: