Lineage for d1o9ib_ (1o9i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317020Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
    automatically mapped to Pfam PF05067
  6. 2317021Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 2317022Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 2317024Domain d1o9ib_: 1o9i B: [92672]
    complexed with ca, mes, mn3, na, o; mutant

Details for d1o9ib_

PDB Entry: 1o9i (more details), 1.33 Å

PDB Description: crystal structure of the y42f mutant of manganese catalase from lactobacillus plantarum at 1.33a resolution
PDB Compounds: (B:) pseudocatalase

SCOPe Domain Sequences for d1o9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9ib_ a.25.1.3 (B:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsflsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOPe Domain Coordinates for d1o9ib_:

Click to download the PDB-style file with coordinates for d1o9ib_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ib_: