SCOPe 2.07: Domain d1o64b_: 1o64 B:

Lineage for d1o64b_ (1o64 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Thermotoga maritima [TaxId:2336] [102699] (3 PDB entries)
   Uniprot Q9X0D2

8. Domain d1o64b_: 1o64 B: [92543]
   structural genomics
   complexed with po4

Details for d1o64b_

PDB Entry: 1o64, 2.1 Å

PDB Description: crystal structure of an atp phosphoribosyltransferase

PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1o64b_:

Sequence; same for both SEQRES and ATOM records:

>d1o64b_ c.94.1.1 (B:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima [TaxId: 2336]}
lklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadig
fcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqryceskg
whcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsyr
tkreevvsfleklqeviehd

Timeline for d1o64b_:

• d1o64b_ first appeared in SCOP 1.67
  
• d1o64b_ appears in SCOPe 2.06
  
• d1o64b_ appears in the current release, SCOPe 2.08