Lineage for d1o64b_ (1o64 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403448Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species)
    there is an additional C-terminal allosteric domain in some species
  7. 403455Species Thermotoga maritima [TaxId:243274] [102699] (2 PDB entries)
  8. 403459Domain d1o64b_: 1o64 B: [92543]
    structural genomics
    complexed with pi

Details for d1o64b_

PDB Entry: 1o64 (more details), 2.1 Å

PDB Description: crystal structure of an atp phosphoribosyltransferase

SCOP Domain Sequences for d1o64b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o64b_ c.94.1.1 (B:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima}
lklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadig
fcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqryceskg
whcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsyr
tkreevvsfleklqeviehd

SCOP Domain Coordinates for d1o64b_:

Click to download the PDB-style file with coordinates for d1o64b_.
(The format of our PDB-style files is described here.)

Timeline for d1o64b_: