SCOPe 2.07: Domain d1o5oc1: 1o5o C:1-209

Lineage for d1o5oc1 (1o5o C:1-209)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [102538] (1 PDB entry)
   TM0721

8. Domain d1o5oc1: 1o5o C:1-209 [92511]
   Other proteins in same PDB: d1o5oa2, d1o5oc2, d1o5od2
   structural genomics
   complexed with so4, u5p

Details for d1o5oc1

PDB Entry: 1o5o, 2.3 Å

PDB Description: crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution

PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1o5oc1:

Sequence; same for both SEQRES and ATOM records:

>d1o5oc1 c.61.1.1 (C:1-209) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]}
mknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpit
ktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklpp
lnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvkiy
vaalderlndhgyiipglgdagdrlfrtk

Timeline for d1o5oc1:

• d1o5oc1 first appeared in SCOP 1.67, called d1o5oc_
  
• d1o5oc1 appears in SCOPe 2.06
  
• d1o5oc1 appears in the current release, SCOPe 2.08