Lineage for d1o2va_ (1o2v A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794282Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
    Uniprot P00760
  8. 1794413Domain d1o2va_: 1o2v A: [92412]
    complexed with 847, ca, cl

Details for d1o2va_

PDB Entry: 1o2v (more details), 1.5 Å

PDB Description: Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1o2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2va_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1o2va_:

Click to download the PDB-style file with coordinates for d1o2va_.
(The format of our PDB-style files is described here.)

Timeline for d1o2va_: