SCOPe 2.06: Domain d1o2va_: 1o2v A:

Lineage for d1o2va_ (1o2v A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d1o2va_: 1o2v A: [92412]
   complexed with 847, ca, cl

Details for d1o2va_

PDB Entry: 1o2v, 1.5 Å

PDB Description: Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors

PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1o2va_:

Sequence; same for both SEQRES and ATOM records:

>d1o2va_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1o2va_:

• d1o2va_ first appeared in SCOP 1.67
  
• d1o2va_ appears in SCOPe 2.05
  
• d1o2va_ appears in SCOPe 2.07
  
• d1o2va_ appears in the current release, SCOPe 2.08