SCOP 1.71: Domain d1nyrb3: 1nyr B:63-241

Lineage for d1nyrb3 (1nyr B:63-241)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)

6. Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [103050] (2 PDB entries)

8. Domain d1nyrb3: 1nyr B:63-241 [92360]
   Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra4, d1nyrb1, d1nyrb2, d1nyrb4
   complexed with atp, thr, zn

Details for d1nyrb3

PDB Entry: 1nyr, 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyrb3:

Sequence, based on SEQRES records:

>d1nyrb3 d.67.1.1 (B:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus}
tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi
ektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcr
gvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker

Sequence, based on observed residues (ATOM records):

>d1nyrb3 d.67.1.1 (B:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus}
tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi
ektmkqivnenmkierkvvsrdeakelelidaipedenvtlysqgdftdlcrgvhvpsta
kikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker

Timeline for d1nyrb3:

• d1nyrb3 first appeared in SCOP 1.67
  
• d1nyrb3 appears in SCOP 1.69
  
• d1nyrb3 appears in SCOP 1.73
  
• d1nyrb3 appears in the current release, SCOPe 2.08