Lineage for d1nyrb3 (1nyr B:63-241)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505899Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 505900Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 505901Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)
  6. 505902Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)
  7. 505905Species Staphylococcus aureus [TaxId:1280] [103050] (2 PDB entries)
  8. 505907Domain d1nyrb3: 1nyr B:63-241 [92360]
    Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra4, d1nyrb1, d1nyrb2, d1nyrb4

Details for d1nyrb3

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyrb3:

Sequence, based on SEQRES records: (download)

>d1nyrb3 d.67.1.1 (B:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus}
tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi
ektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcr
gvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker

Sequence, based on observed residues (ATOM records): (download)

>d1nyrb3 d.67.1.1 (B:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus}
tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi
ektmkqivnenmkierkvvsrdeakelelidaipedenvtlysqgdftdlcrgvhvpsta
kikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker

SCOP Domain Coordinates for d1nyrb3:

Click to download the PDB-style file with coordinates for d1nyrb3.
(The format of our PDB-style files is described here.)

Timeline for d1nyrb3: