SCOP 1.71: Domain d1nyra1: 1nyr A:533-645

Lineage for d1nyra1 (1nyr A:533-645)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [102469] (2 PDB entries)

8. Domain d1nyra1: 1nyr A:533-645 [92354]
   Other proteins in same PDB: d1nyra2, d1nyra3, d1nyra4, d1nyrb2, d1nyrb3, d1nyrb4

Details for d1nyra1

PDB Entry: 1nyr, 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyra1:

Sequence; same for both SEQRES and ATOM records:

>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus}
eetkgafptwlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykirea
qmqkipyqivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr

Timeline for d1nyra1:

• d1nyra1 first appeared in SCOP 1.67
  
• d1nyra1 appears in SCOP 1.69
  
• d1nyra1 appears in SCOP 1.73
  
• d1nyra1 appears in the current release, SCOPe 2.08