Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein) |
Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [103050] (2 PDB entries) |
Domain d1nyra3: 1nyr A:63-241 [92356] Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra4, d1nyrb1, d1nyrb2, d1nyrb4 protein/RNA complex; complexed with atp, thr, zn |
PDB Entry: 1nyr (more details), 2.8 Å
SCOPe Domain Sequences for d1nyra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyra3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus [TaxId: 1280]} tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi ektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcr gvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker
Timeline for d1nyra3:
View in 3D Domains from other chains: (mouse over for more information) d1nyrb1, d1nyrb2, d1nyrb3, d1nyrb4 |