Lineage for d1nyra3 (1nyr A:63-241)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912597Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 1912598Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)
  6. 1912599Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)
  7. 1912606Species Staphylococcus aureus [TaxId:1280] [103050] (2 PDB entries)
  8. 1912607Domain d1nyra3: 1nyr A:63-241 [92356]
    Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra4, d1nyrb1, d1nyrb2, d1nyrb4
    protein/RNA complex; complexed with atp, thr, zn

Details for d1nyra3

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP
PDB Compounds: (A:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyra3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus [TaxId: 1280]}
tpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqi
ektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcr
gvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerker

SCOPe Domain Coordinates for d1nyra3:

Click to download the PDB-style file with coordinates for d1nyra3.
(The format of our PDB-style files is described here.)

Timeline for d1nyra3: