SCOPe 2.07: Domain d1nyqb2: 1nyq B:1-62

Lineage for d1nyqb2 (1nyq B:1-62)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.1: TGS domain [81270] (1 protein)
   automatically mapped to Pfam PF02824

6. Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [102798] (2 PDB entries)

8. Domain d1nyqb2: 1nyq B:1-62 [92351]
   Other proteins in same PDB: d1nyqa1, d1nyqa3, d1nyqa4, d1nyqb1, d1nyqb3, d1nyqb4
   protein/RNA complex; complexed with tsb, zn

Details for d1nyqb2

PDB Entry: 1nyq, 3.2 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate

PDB Compounds: (B:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyqb2:

Sequence; same for both SEQRES and ATOM records:

>d1nyqb2 d.15.10.1 (B:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]}
meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
iv

Timeline for d1nyqb2:

• d1nyqb2 first appeared in SCOP 1.67
  
• d1nyqb2 appears in SCOPe 2.06
  
• d1nyqb2 appears in the current release, SCOPe 2.08