PDB entry 1nyq

View 1nyq on RCSB PDB site
Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate
Class: ligase
Keywords: threonyl-tRNA synthetase, adenylate, LIGASE
Deposited on 2003-02-13, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.205
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase 1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nyqa1, d1nyqa2, d1nyqa3, d1nyqa4
  • Chain 'B':
    Compound: threonyl-tRNA synthetase 1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nyqb1, d1nyqb2, d1nyqb3, d1nyqb4
  • Heterogens: ZN, TSB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nyqA (A:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nyqA (A:)
    iniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsieivt
    pgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqie
    ktmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcrg
    vhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerkerdh
    rkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanvdl
    yktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelgtm
    hryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfrls
    yrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamgke
    etlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafptwl
    apkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyqivv
    gdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nyqB (B:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr