| Class b: All beta proteins [48724] (180 folds) |
| Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) ![]() |
| Family b.61.2.2: Staphostatin [101869] (2 proteins) cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand |
| Protein Staphostatin B (SspC) [101872] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries) |
| Domain d1nycb1: 1nyc B:1-109 [92337] Other proteins in same PDB: d1nyca2, d1nycb2 complexed with cl, so4 |
PDB Entry: 1nyc (more details), 1.4 Å
SCOPe Domain Sequences for d1nycb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nycb1 b.61.2.2 (B:1-109) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
Timeline for d1nycb1: