Lineage for d1nycb1 (1nyc B:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806532Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2806539Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 2806543Protein Staphostatin B (SspC) [101872] (1 species)
  7. 2806544Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)
  8. 2806546Domain d1nycb1: 1nyc B:1-109 [92337]
    Other proteins in same PDB: d1nyca2, d1nycb2
    complexed with cl, so4

Details for d1nycb1

PDB Entry: 1nyc (more details), 1.4 Å

PDB Description: Staphostatins resemble lipocalins, not cystatins in fold.
PDB Compounds: (B:) cysteine protease Inhibitor

SCOPe Domain Sequences for d1nycb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nycb1 b.61.2.2 (B:1-109) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

SCOPe Domain Coordinates for d1nycb1:

Click to download the PDB-style file with coordinates for d1nycb1.
(The format of our PDB-style files is described here.)

Timeline for d1nycb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nycb2