PDB entry 1nyc

View 1nyc on RCSB PDB site
Description: Staphostatins resemble lipocalins, not cystatins in fold.
Class: hydrolase inhibitor
Keywords: Staphostatin B, SspC, cysteine protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2003-02-12, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.202
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cysteine protease Inhibitor
  Species: Staphylococcus aureus [TaxId:196620]
  Gene: staphostatin B (sspC)
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7A189 (2-110)
    • cloning artifact (0-1)
    • see remark 999 (71)
  Domains in SCOPe 2.08: d1nyca1, d1nyca2
• Chain 'B':
  Compound: cysteine protease Inhibitor
  Species: Staphylococcus aureus [TaxId:196620]
  Gene: staphostatin B (sspC)
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7A189 (2-110)
    • cloning artifact (0-1)
    • see remark 999 (71)
  Domains in SCOPe 2.08: d1nycb1, d1nycb2
• Heterogens: CL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nycA (A:)
  gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
  dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nycB (B:)
  gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
  dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv