Lineage for d1nycb_ (1nyc B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 379203Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families) (S)
  5. 379210Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 379214Protein Staphostatin B (SspC) [101872] (1 species)
  7. 379215Species Staphylococcus aureus [TaxId:1280] [101873] (3 PDB entries)
  8. 379217Domain d1nycb_: 1nyc B: [92337]
    complexed with cl, so4

Details for d1nycb_

PDB Entry: 1nyc (more details), 1.4 Å

PDB Description: Staphostatins resemble lipocalins, not cystatins in fold.

SCOP Domain Sequences for d1nycb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nycb_ b.61.2.2 (B:) Staphostatin B (SspC) {Staphylococcus aureus}
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

SCOP Domain Coordinates for d1nycb_:

Click to download the PDB-style file with coordinates for d1nycb_.
(The format of our PDB-style files is described here.)

Timeline for d1nycb_: