SCOPe 2.06: Domain d1nyaa_: 1nya A:

Lineage for d1nyaa_ (1nya A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calerythrin [101179] (1 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Saccharopolyspora erythraea [TaxId:1836] [101180] (1 PDB entry)

8. Domain d1nyaa_: 1nya A: [92335]
   complexed with ca

Details for d1nyaa_

PDB Entry: 1nya

PDB Description: nmr solution structure of calerythrin, an ef-hand calcium-binding protein

PDB Compounds: (A:) Calerythrin

SCOPe Domain Sequences for d1nyaa_:

Sequence; same for both SEQRES and ATOM records:

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}
ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf
dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin
adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg

Timeline for d1nyaa_:

• d1nyaa_ first appeared in SCOP 1.67
  
• d1nyaa_ appears in SCOPe 2.05
  
• d1nyaa_ appears in SCOPe 2.07
  
• d1nyaa_ appears in the current release, SCOPe 2.08