Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calerythrin [101179] (1 species) structurally most similar to sarcoplasmic calcium-binding protein |
Species Saccharopolyspora erythraea [TaxId:1836] [101180] (1 PDB entry) |
Domain d1nyaa_: 1nya A: [92335] complexed with ca |
PDB Entry: 1nya (more details)
SCOPe Domain Sequences for d1nyaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg
Timeline for d1nyaa_: