Lineage for d1nyaa_ (1nya A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319947Protein Calerythrin [101179] (1 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 2319948Species Saccharopolyspora erythraea [TaxId:1836] [101180] (1 PDB entry)
  8. 2319949Domain d1nyaa_: 1nya A: [92335]
    complexed with ca

Details for d1nyaa_

PDB Entry: 1nya (more details)

PDB Description: nmr solution structure of calerythrin, an ef-hand calcium-binding protein
PDB Compounds: (A:) Calerythrin

SCOPe Domain Sequences for d1nyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}
ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf
dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin
adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg

SCOPe Domain Coordinates for d1nyaa_:

Click to download the PDB-style file with coordinates for d1nyaa_.
(The format of our PDB-style files is described here.)

Timeline for d1nyaa_: