Lineage for d1nvpa1 (1nvp A:159-252)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872516Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 872517Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 872518Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 872558Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 872561Domain d1nvpa1: 1nvp A:159-252 [92209]
    Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2

Details for d1nvpa1

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex
PDB Compounds: (A:) tata box binding protein

SCOP Domain Sequences for d1nvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpa1 d.129.1.1 (A:159-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
mvctgakseeqsrlaarkyarvvqklgfpakfld

SCOP Domain Coordinates for d1nvpa1:

Click to download the PDB-style file with coordinates for d1nvpa1.
(The format of our PDB-style files is described here.)

Timeline for d1nvpa1: