Lineage for d1nvpd2 (1nvp D:54-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805664Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 805665Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 805666Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 805673Protein Small chain TOA2, C-terminal domain [88686] (2 species)
  7. 805678Species Human (Homo sapiens) [TaxId:9606] [101843] (1 PDB entry)
  8. 805679Domain d1nvpd2: 1nvp D:54-99 [92214]
    Other proteins in same PDB: d1nvpa1, d1nvpa2, d1nvpb_, d1nvpc_, d1nvpd1

Details for d1nvpd2

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex
PDB Compounds: (D:) Transcription initiation factor IIA gamma chain

SCOP Domain Sequences for d1nvpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpd2 b.56.1.1 (D:54-99) Small chain TOA2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nrvnfrgslntyrfcdnvwtfvlndvefrevtelikvdkvkivacd

SCOP Domain Coordinates for d1nvpd2:

Click to download the PDB-style file with coordinates for d1nvpd2.
(The format of our PDB-style files is described here.)

Timeline for d1nvpd2:

805679
d1nvpd2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nvpd1