SCOPe 2.08: Domain d1nvpa1: 1nvp A:159-252

Lineage for d1nvpa1 (1nvp A:159-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)

8. Domain d1nvpa1: 1nvp A:159-252 [92209]
   Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2
   protein/DNA complex

Details for d1nvpa1

PDB Entry: 1nvp, 2.1 Å

PDB Description: human tfiia/tbp/dna complex

PDB Compounds: (A:) tata box binding protein

SCOPe Domain Sequences for d1nvpa1:

Sequence; same for both SEQRES and ATOM records:

>d1nvpa1 d.129.1.1 (A:159-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
mvctgakseeqsrlaarkyarvvqklgfpakfld

Timeline for d1nvpa1:

• d1nvpa1 first appeared in SCOP 1.67
  
• d1nvpa1 appears in SCOPe 2.07