SCOPe 2.08: Domain d1ntmd2: 1ntm D:196-241

Lineage for d1ntmd2 (1ntm D:196-241)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (19 PDB entries)
   Uniprot P00125

8. Domain d1ntmd2: 1ntm D:196-241 [92128]
   Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
   complexed with fes, hem

Details for d1ntmd2

PDB Entry: 1ntm, 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ntmd2:

Sequence; same for both SEQRES and ATOM records:

>d1ntmd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1ntmd2:

• d1ntmd2 first appeared in SCOP 1.67
  
• d1ntmd2 appears in SCOPe 2.07