Lineage for d1nlta3 (1nlt A:139-212)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038315Fold g.54: DnaJ/Hsp40 cysteine-rich domain [57937] (1 superfamily)
    metal(zinc)-bound extended beta-hairpin fold
  4. 3038316Superfamily g.54.1: DnaJ/Hsp40 cysteine-rich domain [57938] (1 family) (S)
    automatically mapped to Pfam PF00684
  5. 3038317Family g.54.1.1: DnaJ/Hsp40 cysteine-rich domain [57939] (2 proteins)
  6. 3038321Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain [103634] (1 species)
  7. 3038322Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103635] (1 PDB entry)
  8. 3038323Domain d1nlta3: 1nlt A:139-212 [91965]
    Other proteins in same PDB: d1nlta1, d1nlta2
    complexed with zn

Details for d1nlta3

PDB Entry: 1nlt (more details), 2.7 Å

PDB Description: the crystal structure of hsp40 ydj1
PDB Compounds: (A:) Mitochondrial protein import protein MAS5

SCOPe Domain Sequences for d1nlta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kqilckecegrggkkgavkkctscngqgikfvtrqmgpmiqrfqtecdvchgtgdiidpk
drckscngkkvene

SCOPe Domain Coordinates for d1nlta3:

Click to download the PDB-style file with coordinates for d1nlta3.
(The format of our PDB-style files is described here.)

Timeline for d1nlta3: