Lineage for d1nlta2 (1nlt A:258-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770358Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2770359Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) (S)
  5. 2770360Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)
  6. 2770369Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain [101560] (1 species)
  7. 2770370Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101561] (1 PDB entry)
  8. 2770372Domain d1nlta2: 1nlt A:258-337 [91964]
    Other proteins in same PDB: d1nlta3
    complexed with zn

Details for d1nlta2

PDB Entry: 1nlt (more details), 2.7 Å

PDB Description: the crystal structure of hsp40 ydj1
PDB Compounds: (A:) Mitochondrial protein import protein MAS5

SCOPe Domain Sequences for d1nlta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp
ipkyggygnliikftikdpe

SCOPe Domain Coordinates for d1nlta2:

Click to download the PDB-style file with coordinates for d1nlta2.
(The format of our PDB-style files is described here.)

Timeline for d1nlta2: