Lineage for d1nl7c1 (1nl7 C:3-268)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1626715Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1626945Protein Biosynthetic thiolase [53905] (1 species)
  7. 1626946Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
    Uniprot P07097
  8. 1626991Domain d1nl7c1: 1nl7 C:3-268 [91958]
    complexed with coa, so4

Details for d1nl7c1

PDB Entry: 1nl7 (more details), 1.9 Å

PDB Description: z. ramigera biosynthetic thiolase, acetylated enzyme complexed with coa at ph 9.5
PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1nl7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl7c1 c.95.1.1 (C:3-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1nl7c1:

Click to download the PDB-style file with coordinates for d1nl7c1.
(The format of our PDB-style files is described here.)

Timeline for d1nl7c1: