Lineage for d1nl7c1 (1nl7 C:3-268)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916808Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)
  7. 2916809Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
    Uniprot P07097
  8. 2916844Domain d1nl7c1: 1nl7 C:3-268 [91958]
    Other proteins in same PDB: d1nl7a2, d1nl7b2, d1nl7c2, d1nl7d2
    complexed with coa, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1nl7c1

PDB Entry: 1nl7 (more details), 1.9 Å

PDB Description: z. ramigera biosynthetic thiolase, acetylated enzyme complexed with coa at ph 9.5
PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1nl7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl7c1 c.95.1.1 (C:3-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1nl7c1:

Click to download the PDB-style file with coordinates for d1nl7c1.
(The format of our PDB-style files is described here.)

Timeline for d1nl7c1: