Lineage for d1nl7b2 (1nl7 B:269-392)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164705Protein Biosynthetic thiolase [53905] (1 species)
  7. 2164706Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
    Uniprot P07097
  8. 2164750Domain d1nl7b2: 1nl7 B:269-392 [91957]
    complexed with coa, so4

Details for d1nl7b2

PDB Entry: 1nl7 (more details), 1.9 Å

PDB Description: z. ramigera biosynthetic thiolase, acetylated enzyme complexed with coa at ph 9.5
PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1nl7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl7b2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d1nl7b2:

Click to download the PDB-style file with coordinates for d1nl7b2.
(The format of our PDB-style files is described here.)

Timeline for d1nl7b2: