SCOPe 2.03: Domain d1nl1a1: 1nl1 A:66-147

Lineage for d1nl1a1 (1nl1 A:66-147)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Prothrombin [57448] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)

8. Domain d1nl1a1: 1nl1 A:66-147 [91949]
   Other proteins in same PDB: d1nl1a2
   complexed with ca, nag

Details for d1nl1a1

PDB Entry: 1nl1, 1.9 Å

PDB Description: bovine prothrombin fragment 1 in complex with calcium ion

PDB Compounds: (A:) Prothrombin

SCOPe Domain Sequences for d1nl1a1:

Sequence; same for both SEQRES and ATOM records:

>d1nl1a1 g.14.1.1 (A:66-147) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqd

Timeline for d1nl1a1:

• d1nl1a1 first appeared in SCOP 1.67
  
• d1nl1a1 appears in SCOPe 2.02
  
• d1nl1a1 appears in SCOPe 2.04
  
• d1nl1a1 appears in the current release, SCOPe 2.08