PDB entry 1nl1

View 1nl1 on RCSB PDB site
Description: bovine prothrombin fragment 1 in complex with calcium ion
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-01-06, released 2003-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00735 (0-146)
      • modified residue (6-7)
      • modified residue (14)
      • modified residue (16)
      • modified residue (19-20)
      • modified residue (25-26)
      • modified residue (29)
      • modified residue (32)
    Domains in SCOPe 2.03: d1nl1a1, d1nl1a2
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nl1A (A:)
    ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
    clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
    sitgpwcyttsptlrreecsvpvcgqd