Lineage for d1nl1a1 (1nl1 A:66-147)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033377Protein Prothrombin [57448] (1 species)
  7. 3033378Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 3033379Domain d1nl1a1: 1nl1 A:66-147 [91949]
    Other proteins in same PDB: d1nl1a2
    complexed with ca, nag

Details for d1nl1a1

PDB Entry: 1nl1 (more details), 1.9 Å

PDB Description: bovine prothrombin fragment 1 in complex with calcium ion
PDB Compounds: (A:) Prothrombin

SCOPe Domain Sequences for d1nl1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl1a1 g.14.1.1 (A:66-147) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqd

SCOPe Domain Coordinates for d1nl1a1:

Click to download the PDB-style file with coordinates for d1nl1a1.
(The format of our PDB-style files is described here.)

Timeline for d1nl1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nl1a2