Lineage for d1nkea2 (1nke A:469-876)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424453Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 424454Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 424455Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (24 PDB entries)
  8. 424465Domain d1nkea2: 1nke A:469-876 [91940]
    Other proteins in same PDB: d1nkea1
    complexed with dcp, mg, so4, suc

Details for d1nkea2

PDB Entry: 1nke (more details), 1.8 Å

PDB Description: a bacillus dna polymerase i product complex bound to a cytosine- thymine mismatch after a single round of primer extension, following incorporation of dctp.

SCOP Domain Sequences for d1nkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkea2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d1nkea2:

Click to download the PDB-style file with coordinates for d1nkea2.
(The format of our PDB-style files is described here.)

Timeline for d1nkea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nkea1