PDB entry 1nke

View 1nke on RCSB PDB site
Description: a bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Deposited on 2003-01-02, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkeA (A:)
    akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak