| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins) contains Pfam 00929 |
| Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
| Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (32 PDB entries) |
| Domain d1nk0a1: 1nk0 A:297-468 [91921] Other proteins in same PDB: d1nk0a2 complexed with mes, so4, suc |
PDB Entry: 1nk0 (more details), 1.7 Å
SCOP Domain Sequences for d1nk0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nk0a1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d1nk0a1: