Lineage for d1nk0a1 (1nk0 A:297-468)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488631Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 488665Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 488666Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (31 PDB entries)
  8. 488671Domain d1nk0a1: 1nk0 A:297-468 [91921]
    Other proteins in same PDB: d1nk0a2

Details for d1nk0a1

PDB Entry: 1nk0 (more details), 1.7 Å

PDB Description: adenine-guanine mismatch at the polymerase active site

SCOP Domain Sequences for d1nk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk0a1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d1nk0a1:

Click to download the PDB-style file with coordinates for d1nk0a1.
(The format of our PDB-style files is described here.)

Timeline for d1nk0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk0a2